Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg

Product Details
Customization: Available
CAS No.: 910463-68-2
Variety: Lyophilized Powder
Still deciding? Get samples of $ !
Request Sample
Gold Member Since 2024

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

High Repeat Buyers Choice
More than 50% of buyers repeatedly choose the supplier
In-stock Capacity
The supplier has In-stock capacity
Fast Delivery
The supplier can deliver the goods within 15 days
R&D Capabilities
The supplier has 1 R&D engineers, you can check the Audit Report for more information
to see all verified strength labels (9)
  • Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg
  • Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg
  • Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg
  • Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg
  • Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg
  • Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg
Find Similar Products

Basic Info.

Feature
Lyophilized Powder
Usage
Lyophilized Powder
Status
Lyophilized Powder
Specification Customization
10 Mg
Shelf Life
3 Year
Minimum Order Quantity
20 Vials
Custom Label
From 100 Vials
User Group
Adult
Delivery Time
2-3 Days
Packing
Box
Save
Refrigerate
Transport Package
Box
Specification
10 mg
Trademark
HUG
Origin
China

Product Description

Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

Specifications

Chemistry
Sequence one letter code
  • [LL-37, 37 aa]
Sequence three letter code
  • H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS registry number
  • 154947-66-7
Molecular Formula
  • C205H340N60O53
Molecular Mass/ Weight
  • 4493.6

Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mgOffer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg

Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mgOffer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mgOffer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg

 
Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mgOffer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mgOffer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg
 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier