Offer 99.9% Peptide Antibacterial Protein Ll-37 Peptides Ll- 37 Human 10mg

• CAS No.: 910463-68-2
• Variety: Lyophilized Powder
• Feature: Lyophilized Powder
• Usage: Lyophilized Powder
• Status: Lyophilized Powder
• Specification Customization: 10 Mg
• Shelf Life: 3 Year
• Minimum Order Quantity: 20 Vials
• Custom Label: From 100 Vials
• User Group: Adult
• Delivery Time: 2-3 Days
• Packing: Box
• Save: Refrigerate
• Transport Package: Box
• Specification: 10 mg
• Trademark: HUG
• Origin: China

Product Description

Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

Specifications

Chemistry
Sequence one letter code	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence three letter code	H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS registry number	154947-66-7
Molecular Formula	C205H340N60O53
Molecular Mass/ Weight	4493.6